DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa60

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster


Alignment Length:182 Identity:36/182 - (19%)
Similarity:66/182 - (36%) Gaps:57/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFKFNNVNF-----DPLTET-----------YGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGK 60
            |...|:|..     |.|||.           |.||:| :.:.....:|.||...:..|:|.|:.:
  Fly    28 LCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWY-EDITSSTRFFALAAVYNLAIIGLIVAE 91

  Fly    61 VEGH-------------LDNWH------------------------GHVTALTVSPDYRRLGLAA 88
            ::.:             .|..:                        |::.:|.|...:||.|:.:
  Fly    92 IKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGS 156

  Fly    89 LLMSFLED---ISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYS 137
            ||:..|.:   .:|:.....:.|....:||.||..|....:.::..:..||:
  Fly   157 LLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYYN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 36/182 (20%)
Acetyltransf_1 51..126 CDD:278980 20/114 (18%)
Naa60NP_996032.1 RimI 74..207 CDD:223532 23/132 (17%)
Acetyltransf_1 <136..198 CDD:278980 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.