DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa60

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_008765741.1 Gene:Naa60 / 363545 RGDID:1308915 Length:295 Species:Rattus norvegicus


Alignment Length:214 Identity:36/214 - (16%)
Similarity:66/214 - (30%) Gaps:87/214 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKW-------PEYFQLAESPSGQIMGYIMGK 60
            :||....||:        |.:....|..|..:|...|       .::|.||.:..|.|:|.|:.:
  Rat    14 SLRLLCHDDI--------DTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE 70

  Fly    61 VEGH------------------------------------------------------------- 64
            ::..                                                             
  Rat    71 IKNRTKIHKETGIHCVLAGLKLRPACLCLSSAGVQDRAPMRGLLEVVSLEVKEVSLKQQLVGRDG 135

  Fly    65 --------LDNWHGHVTALTVSPDYRRLGLAALLMSFLED---ISEKKRAYFVDLFVRKSNQVAI 118
                    :|....::.:|.|..::|:.|:.:||:..|:|   .:.:.....:.|.|..:|..||
  Rat   136 DILASSFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAI 200

  Fly   119 NMYTNLGYIIYRTILEYYS 137
            |.|.|..:..:..:..|||
  Rat   201 NFYENRDFRQHHYLPYYYS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 36/214 (17%)
Acetyltransf_1 51..126 CDD:278980 21/146 (14%)
Naa60XP_008765741.1 Acetyltransf_1 <137..208 CDD:395465 17/70 (24%)
TIM <192..>256 CDD:419668 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.