DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa20

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001102065.1 Gene:Naa20 / 362228 RGDID:1307713 Length:188 Species:Rattus norvegicus


Alignment Length:187 Identity:118/187 - (63%)
Similarity:144/187 - (77%) Gaps:15/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGY--------- 56
            |||||.|||||||:|||:|.||||||||:.||.||||.|||||.:||:|.|::|||         
  Rat     1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYSKYSTTSTF 65

  Fly    57 -IMGKVEGHL--DNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAI 118
             :|||.||.:  :.||||||||:|:|::|||||||.||..||:|||:|..:|||||||.|||||:
  Rat    66 LVMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAV 130

  Fly   119 NMYTNLGYIIYRTILEYYS---GDQDEDAYDMRKALSRDVNKKSVIPYTQPITMREL 172
            |||..|||.:|||::||||   |:.||||||||||||||..|||:||...|:...::
  Rat   131 NMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 107/164 (65%)
Acetyltransf_1 51..126 CDD:278980 50/86 (58%)
Naa20NP_001102065.1 RimI 1..166 CDD:223532 107/164 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342727
Domainoid 1 1.000 131 1.000 Domainoid score I5038
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7165
Inparanoid 1 1.050 247 1.000 Inparanoid score I3178
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 1 1.000 - - oto98841
orthoMCL 1 0.900 - - OOG6_102129
Panther 1 1.100 - - LDO PTHR45910
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3652
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.