DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa20B

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster


Alignment Length:170 Identity:69/170 - (40%)
Similarity:110/170 - (64%) Gaps:13/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMG-KVEGH 64
            ||:.|.|..:|||||||:..|||.|.|.|.|....:.:.||....|::|...:||:|:| :||..
  Fly     1 MTSPRLFVLEDLFKFNNIVMDPLAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDA 65

  Fly    65 LDN--------W-HGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINM 120
            .::        | |||::||.|:.|||:|||...|::.:.|:.::::.:::|||||:.|.:||.:
  Fly    66 TESFGDAKTMTWNHGHISALAVAQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGL 130

  Fly   121 YTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSV 160
            |.:|||:.||.|.::|:   |:..|:||..||.||::||:
  Fly   131 YESLGYVKYRWIPKFYA---DDHGYEMRLPLSSDVDRKSL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 63/159 (40%)
Acetyltransf_1 51..126 CDD:278980 31/84 (37%)
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 48/133 (36%)
Acetyltransf_1 50..137 CDD:278980 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452068
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S635
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D121425at6656
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45910
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.