DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa30B

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster


Alignment Length:132 Identity:37/132 - (28%)
Similarity:63/132 - (47%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTETYGLSFYTQYLAKWPE--YFQLAESPSGQIMGYIMGKVEGHLDNW-HGHVTALTVSPDYRRL 84
            |:|.|.:..|..::..||:  :|.|   ...:.:|.|:.|:|...|.: .|::..|.|..:||:.
  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFAL---DGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKR 135

  Fly    85 GLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQDEDAYDMRK 149
            |:...|.....|....:.|..:.|....||:.|:.:|.:||:|..|..|.||....  ||:.::.
  Fly   136 GIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGM--DAFHLKL 198

  Fly   150 AL 151
            .|
  Fly   199 ML 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 36/130 (28%)
Acetyltransf_1 51..126 CDD:278980 20/75 (27%)
Naa30BNP_728606.1 rimI 70..194 CDD:273701 35/124 (28%)
Acetyltransf_1 99..177 CDD:278980 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466528
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.