DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa30A

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster


Alignment Length:119 Identity:34/119 - (28%)
Similarity:59/119 - (49%) Gaps:1/119 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLA 87
            |:|.|.:..|..::..||:...|| |...|.:|.|:.|::.|::...|::..|.|..:||:|.:.
  Fly   251 LSEPYSIYTYRYFIYNWPKLCFLA-SHDNQYVGAIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIG 314

  Fly    88 ALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQD 141
            ..|::...:......|..|.|.....||.|:.:|.|||::..:.:..||....|
  Fly   315 TTLVTKAIEAMLADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYYLNGVD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 34/119 (29%)
Acetyltransf_1 51..126 CDD:278980 21/74 (28%)
Naa30ANP_726727.1 rimI 242..370 CDD:273701 34/119 (29%)
Acetyltransf_1 276..354 CDD:278980 22/77 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466531
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.