DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Nat8l

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001001985.3 Gene:Nat8l / 269642 MGIID:2447776 Length:299 Species:Mus musculus


Alignment Length:101 Identity:24/101 - (23%)
Similarity:34/101 - (33%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYR--------RLGLAALL 90
            ||..|.|..........|.::|.:..:.... ||   .|..|.:|.|.|        .||...|.
Mouse   171 QYYMKPPGSCFWVAVLDGNVVGIVAARAHEE-DN---TVELLRMSVDSRFRGKGIAKALGRRVLE 231

  Fly    91 MSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGY 126
            .:.|.:.|.      |.|........|..:|.:||:
Mouse   232 FAMLHNYSA------VVLGTTAVKVAAHKLYESLGF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 24/101 (24%)
Acetyltransf_1 51..126 CDD:278980 19/82 (23%)
Nat8lNP_001001985.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
RimI <146..270 CDD:223532 24/101 (24%)
Acetyltransf_1 187..262 CDD:278980 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.