DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and naa20

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_587922.1 Gene:naa20 / 2539279 PomBaseID:SPCC16C4.12 Length:180 Species:Schizosaccharomyces pombe


Alignment Length:164 Identity:89/164 - (54%)
Similarity:113/164 - (68%) Gaps:4/164 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQ--IMGYIMGKVEG 63
            ||..|.|...|||.|||:|.||||||:.:|||..||.|||....:.||....  :|||||||.||
pombe     1 MTDTRKFKATDLFSFNNINLDPLTETFNISFYLSYLNKWPSLCVVQESDLSDPTLMGYIMGKSEG 65

  Fly    64 HLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYII 128
            ....||.||||:||:|:.||||||..:|.:||.:...:.|:|||||||.||.:||:.|..|||.:
pombe    66 TGKEWHTHVTAITVAPNSRRLGLARTMMDYLETVGNSENAFFVDLFVRASNALAIDFYKGLGYSV 130

  Fly   129 YRTILEYYSG--DQDEDAYDMRKALSRDVNKKSV 160
            ||.::.|||.  .:|||::||||.||||||::|:
pombe   131 YRRVIGYYSNPHGKDEDSFDMRKPLSRDVNRESI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 82/153 (54%)
Acetyltransf_1 51..126 CDD:278980 41/76 (54%)
naa20NP_587922.1 RimI 1..155 CDD:223532 82/153 (54%)
Acetyltransf_1 52..128 CDD:278980 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1874
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7165
Inparanoid 1 1.050 182 1.000 Inparanoid score I1113
OMA 1 1.010 - - QHG53973
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 1 1.000 - - oto102144
orthoMCL 1 0.900 - - OOG6_102129
Panther 1 1.100 - - LDO PTHR45910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2204
SonicParanoid 1 1.000 - - X3652
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.