powered by:
Protein Alignment Naa20A and Kat14
DIOPT Version :9
Sequence 1: | NP_001259714.1 |
Gene: | Naa20A / 32962 |
FlyBaseID: | FBgn0031043 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_852082.2 |
Gene: | Kat14 / 228714 |
MGIID: | 1917264 |
Length: | 779 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 33/66 - (50%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 HVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEY 135
:::.|.|.|::||.|:|..::..|......|. |.|.|..||. |:.:|...|:.....:|::
Mouse 697 YISFLLVHPEWRRAGIATFMIYHLIQTCMGKD---VTLHVSASNP-AMLLYQKFGFKTEEYVLDF 757
Fly 136 Y 136
|
Mouse 758 Y 758
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0456 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.