DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and natb-1

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_505053.1 Gene:natb-1 / 190814 WormBaseID:WBGene00022394 Length:173 Species:Caenorhabditis elegans


Alignment Length:172 Identity:105/172 - (61%)
Similarity:136/172 - (79%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHL 65
            |||||||...|:|||||||.|..|||||..||..|:..:|||:|:||.|:|:||.|:|||:||..
 Worm     1 MTTLRPFDVMDMFKFNNVNLDINTETYGFQFYLHYMMNYPEYYQVAEHPNGEIMAYVMGKIEGRD 65

  Fly    66 DNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYR 130
            .|||||||||:|:|::|||||||.:|.|||..||.:||||||||||.||::||.:|..|||::||
 Worm    66 TNWHGHVTALSVAPNFRRLGLAAYMMEFLERTSEARRAYFVDLFVRVSNKIAIELYKKLGYVVYR 130

  Fly   131 TILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPITMREL 172
            .|:.||:||:||||:||||:||||..||:::|....:..|::
 Worm   131 QIIGYYTGDRDEDAFDMRKSLSRDPEKKAMVPLNYLVHSRDV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 97/149 (65%)
Acetyltransf_1 51..126 CDD:278980 49/74 (66%)
natb-1NP_505053.1 RimI 1..149 CDD:223532 95/147 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I3205
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7165
Inparanoid 1 1.050 232 1.000 Inparanoid score I2176
Isobase 1 0.950 - 0 Normalized mean entropy S635
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 1 1.000 - - oto17733
orthoMCL 1 0.900 - - OOG6_102129
Panther 1 1.100 - - LDO PTHR45910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2204
SonicParanoid 1 1.000 - - X3652
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.