DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and nat8

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_001342614.1 Gene:nat8 / 100002956 ZFINID:ZDB-GENE-141216-110 Length:221 Species:Danio rerio


Alignment Length:105 Identity:23/105 - (21%)
Similarity:42/105 - (40%) Gaps:16/105 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLF 109
            :||| .|:::|.: |......|.....:..::|...:|..|:|..|...:.|.:.::....|.|.
Zfish   111 VAES-QGRVVGTV-GCFPSENDKNFLELKRMSVKKAHRGKGIAKALCRTVADFARERGYLGVILH 173

  Fly   110 VRKSNQVAINMYTNLGYIIYR--------------TILEY 135
            .......|..:|.::||...|              |::||
Zfish   174 TSVVQTDAQKLYEHMGYHKVREFSAPEFIAKLTNFTLMEY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 23/105 (22%)
Acetyltransf_1 51..126 CDD:278980 14/74 (19%)
nat8XP_001342614.1 Acetyltransf_1 76..190 CDD:306954 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.