DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and TRX2

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_011725.3 Gene:TRX2 / 853123 SGDID:S000003441 Length:104 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:27/100 - (27%)
Similarity:42/100 - (42%) Gaps:24/100 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKI----------KLELGGDNLQLAIC 66
            |.|..|::..| .||  |:|:|.::.|||||..:...:.|.          ||::  |.:.....
Yeast     5 LKSASEYDSAL-ASGDKLVVVDFFATWCGPCKMIAPMIEKFAEQYSDAAFYKLDV--DEVSDVAQ 66

  Fly    67 KAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTD 101
            ||         ...|.||.:|...||.:..:.|.:
Yeast    67 KA---------EVSSMPTLIFYKGGKEVTRVVGAN 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 27/99 (27%)
DUF4746 233..508 CDD:292550
TRX2NP_011725.3 thioredoxin 6..104 CDD:200072 26/98 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.