DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and TO2

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_564371.1 Gene:TO2 / 839988 AraportID:AT1G31020 Length:159 Species:Arabidopsis thaliana


Alignment Length:108 Identity:28/108 - (25%)
Similarity:46/108 - (42%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQ--RSGLLVLDIY--SEWCGPCLGMVGSLRKIKLELGG-----DNLQLAICKAG 69
            |.|:.||...|.  |.|.|....|  :.|||||    ..:..:.|||..     ...::.|.:.|
plant    54 LKSEAEFNSALSKARDGSLPSVFYFTAAWCGPC----RLISPVILELSNKYPDVTTYKVDIDEGG 114

  Fly    70 SISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRM 112
            ..:.:.:.|..:.||..|...|.....:.|.||.:|.:::.::
plant   115 LSNAIGKLNVSAVPTLQFFKGGVKKAEIVGVDVVRLKSVMEQL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 28/105 (27%)
DUF4746 233..508 CDD:292550
TO2NP_564371.1 TRX_family 58..146 CDD:239245 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.