DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and ATTRX4

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_173403.1 Gene:ATTRX4 / 838562 AraportID:AT1G19730 Length:119 Species:Arabidopsis thaliana


Alignment Length:109 Identity:27/109 - (24%)
Similarity:49/109 - (44%) Gaps:18/109 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EFEKFLQRSGLLVLDIYSEWCGPC---LGMVGSLRK------IKLELGGDNLQLAICKAGSISYL 74
            :.:|..:.:.|:|:|..:.||.||   ..:...|.|      |..::..|.||         |..
plant    20 QLDKAKESNKLIVIDFTASWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDELQ---------SVA 75

  Fly    75 KRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMA 118
            |.|..::.||::|:.:|:.::.:.|.:...|.|.|.:....|.|
plant    76 KEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTGVTTA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 25/100 (25%)
DUF4746 233..508 CDD:292550
ATTRX4NP_173403.1 TRX_family 20..110 CDD:239245 24/98 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.