powered by:
Protein Alignment CG14221 and ACHT4
DIOPT Version :9
Sequence 1: | NP_001259713.1 |
Gene: | CG14221 / 32961 |
FlyBaseID: | FBgn0031042 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_172333.1 |
Gene: | ACHT4 / 837379 |
AraportID: | AT1G08570 |
Length: | 275 |
Species: | Arabidopsis thaliana |
Alignment Length: | 39 |
Identity: | 12/39 - (30%) |
Similarity: | 22/39 - (56%) |
Gaps: | 2/39 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 GVQQLQADLASDEEFEKFLQRSG--LLVLDIYSEWCGPC 42
|::....:::|.:|....|..:| |:|:|.:|..||.|
plant 94 GLKDNMREISSAQELVDSLTNAGDKLVVVDFFSPGCGGC 132
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0907 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.