DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and TRX3

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_199112.1 Gene:TRX3 / 834313 AraportID:AT5G42980 Length:118 Species:Arabidopsis thaliana


Alignment Length:117 Identity:24/117 - (20%)
Similarity:51/117 - (43%) Gaps:13/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKGGVQQLQADLASD--EEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQL 63
            ||.:|.|  :......|  |:.:...:...|:|:|..:.||.||    ..:..:..:|...:|.:
plant     1 MAAEGEV--IACHTVEDWTEKLKAANESKKLIVIDFTATWCPPC----RFIAPVFADLAKKHLDV 59

  Fly    64 AICKAGSISYL----KRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITR 111
            ...|. .:..|    :.|..::.||::|:..|:....:.|....:::|.:.:
plant    60 VFFKV-DVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 20/105 (19%)
DUF4746 233..508 CDD:292550
TRX3NP_199112.1 TRX_family 18..109 CDD:239245 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.