powered by:
Protein Alignment CG14221 and ACHT2
DIOPT Version :9
Sequence 1: | NP_001259713.1 |
Gene: | CG14221 / 32961 |
FlyBaseID: | FBgn0031042 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_849469.1 |
Gene: | ACHT2 / 829088 |
AraportID: | AT4G29670 |
Length: | 236 |
Species: | Arabidopsis thaliana |
Alignment Length: | 45 |
Identity: | 15/45 - (33%) |
Similarity: | 23/45 - (51%) |
Gaps: | 2/45 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 DLASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKIKLE 55
|:.|.|||...|..:| |::::.|..||..|..:...|.|..:|
plant 107 DIHSTEEFLSALSGAGERLVIVEFYGTWCASCRALFPKLCKTAVE 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0907 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1482186at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.