DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and ACHT1

DIOPT Version :10

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_194346.1 Gene:ACHT1 / 828722 AraportID:AT4G26160 Length:221 Species:Arabidopsis thaliana


Alignment Length:86 Identity:24/86 - (27%)
Similarity:42/86 - (48%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKGGVQQLQADLASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRK--------IKLELG 57
            :|.|...:  |:.|.|:|...|:.:|  |:::|.|..|||.|..|...|.|        :.|::.
plant    89 RKAGPNMI--DITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVN 151

  Fly    58 GDNLQLAICKAGSISYLKRFN 78
            .|. ..::||:.::..|..|:
plant   152 FDE-NKSLCKSLNVKVLPYFH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 11..111 CDD:469754 22/78 (28%)
DUF4746 233..508 CDD:435025
ACHT1NP_194346.1 TRX_family 102..198 CDD:239245 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.