DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and ACHT1

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_194346.1 Gene:ACHT1 / 828722 AraportID:AT4G26160 Length:221 Species:Arabidopsis thaliana


Alignment Length:86 Identity:24/86 - (27%)
Similarity:42/86 - (48%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKGGVQQLQADLASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRK--------IKLELG 57
            :|.|...:  |:.|.|:|...|:.:|  |:::|.|..|||.|..|...|.|        :.|::.
plant    89 RKAGPNMI--DITSAEQFLNALKDAGDRLVIVDFYGTWCGSCRAMFPKLCKTAKEHPNILFLKVN 151

  Fly    58 GDNLQLAICKAGSISYLKRFN 78
            .|. ..::||:.::..|..|:
plant   152 FDE-NKSLCKSLNVKVLPYFH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 22/78 (28%)
DUF4746 233..508 CDD:292550
ACHT1NP_194346.1 TRX_family 102..198 CDD:239245 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.