DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and TDX

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_188415.2 Gene:TDX / 821056 AraportID:AT3G17880 Length:380 Species:Arabidopsis thaliana


Alignment Length:365 Identity:69/365 - (18%)
Similarity:132/365 - (36%) Gaps:114/365 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 FAAENPLSPEVIEQLYDKELLMCFWK---------VDEVLGTPPTVLRQYAHEL-TKETIKPPDE 278
            |..:..|:|.:   |:|..|:  |:|         |.::..|.    |.|..:. ||.:..|..:
plant    13 FVEQLKLNPSI---LHDPSLV--FFKEYLRSLGAQVPKIEKTE----RDYEDKAETKPSFSPKHD 68

  Fly   279 FNEEEITVPPMIVPLEVTVEISDP---EPSTENSQVQPDAVHLAEIRSENVAEAEEETETEAEA- 339
            .::::|        :|..||:.:.   ||  :|...||.....||:..||..:|:.|.....|| 
plant    69 DDDDDI--------MESDVELDNSDVVEP--DNEPPQPMGDPTAEVTDENRDDAQSEKSKAMEAI 123

  Fly   340 --GAAPEAKTAPVAAKRTKTIRIPPIWVPSDQRTHAALIYTYFRAQTTTFL---PPDPVPEPPHI 399
              |...||     ....||.:.:.|.         :|::|.   .:.:.||   .|:......::
plant   124 SDGRFDEA-----IEHLTKAVMLNPT---------SAILYA---TRASVFLKVKKPNAAIRDANV 171

  Fly   400 VMIFDA-----YKKKDLAILLETCREDIPLYGFFNGDNPLTAQFIANSVEKYNAKPYVPTDKIVL 459
            .:.|::     ||.:.:|                   ..:..|:...:.:.:.|......::|..
plant   172 ALQFNSDSAKGYKSRGMA-------------------KAMLGQWEEAAADLHVASKLDYDEEIGT 217

  Fly   460 KVNKVNSPTIPTLMAYGPSYVSANSVVGHQEATQFFPANYKSALQEEEELHAVKTEKPKKRKKNK 524
            .:.||..              :|..:..|:...|        .|::|:||...:.|:.|:::..:
plant   218 MLKKVEP--------------NAKRIEEHRRKYQ--------RLRKEKELQRAERERRKQQEAQE 260

  Fly   525 KGGDPEESGKADAGPADAQM-----EAEEAVKTSPEEGAS 559
            :        :|.|...|.::     .:|...||...:.||
plant   261 R--------EAQAALNDGEVISIHSTSELEAKTKAAKKAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274
DUF4746 233..508 CDD:292550 54/298 (18%)
TDXNP_188415.2 Hip_N 6..44 CDD:271228 8/35 (23%)
TPR repeat 112..140 CDD:276809 9/32 (28%)
PLN03088 117..>213 CDD:215568 19/131 (15%)
TPR repeat 145..175 CDD:276809 5/32 (16%)
TPR repeat 180..206 CDD:276809 4/44 (9%)
PRK14552 <200..256 CDD:237753 13/77 (17%)
TRX_family 292..374 CDD:239245 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.