DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and ACHT3

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_180885.1 Gene:ACHT3 / 817890 AraportID:AT2G33270 Length:273 Species:Arabidopsis thaliana


Alignment Length:172 Identity:34/172 - (19%)
Similarity:65/172 - (37%) Gaps:48/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKI-----KLELGGDNLQL------AI 65
            :.|.::....|:.:|  |:|:|.:|..||.|..:...:.||     ::|.    ||:      ::
plant    98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPEVEF----LQVNYEEHRSL 158

  Fly    66 CKAGSISYLK--RFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEIT 128
            |::.:|..|.  ||.:.|        ||:..:.       .......|..:..:.|.......|.
plant   159 CQSLNIHVLPFFRFYRGS--------SGRVCSF-------SCTNATIRKFKEALEKHGREQCSIG 208

  Fly   129 ELQPIELEQLEVRNKALRLAEEIELAESRRKRLEYLHSVTDC 170
            |.:.:|.::|              :|.:..|.|.:.:..|.|
plant   209 ETKGLEEKEL--------------VAMAANKDLSFDYKPTSC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 23/111 (21%)
DUF4746 233..508 CDD:292550
ACHT3NP_180885.1 TRX_family 111..>175 CDD:239245 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.