DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and Nme8

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_853622.2 Gene:Nme8 / 73412 MGIID:1920662 Length:586 Species:Mus musculus


Alignment Length:610 Identity:130/610 - (21%)
Similarity:215/610 - (35%) Gaps:181/610 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKGGVQQLQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDN-LQLA 64
            ||.|....|||:.:.|...:::.|...||.|:|:|..|||||..:....||:|.||..|. |...
Mouse     1 MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDEILHFV 65

  Fly    65 ICKAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVP----KLVAMI---TRMLQSTMAKETH 122
            :.:|.:|..|:.|..|.||.::|..:||.|..:.|.:.|    |::.:|   .:::...|.:..:
Mouse    66 VAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKIVAGEMDRPQY 130

  Fly   123 LSYEITELQPIELEQLEVRNKALRLAEEIELAESRRKRLEYLHSVTDCIMANLPDIGITVFGPQV 187
            :  ||..:..|:.|..||:.::  .||...:|..:                  ||..:.    :.
Mouse   131 V--EIPLVDAIDEEYGEVQYES--AAEVYNMAIIK------------------PDAVLM----RK 169

  Fly   188 NRDMFKKLSEPADPLKIQCKDRKVFTILPSDIATVNFAAENPLSPEVIEQLYDKELLMCFWKVDE 252
            |.::.:|:::....::||                     ||.:.||                   
Mouse   170 NIEVREKIAKEGFVIEIQ---------------------ENLILPE------------------- 194

  Fly   253 VLGTPPTVLRQ-YAHELTKETIKPPDEFNEEEITVPPMIVPLEVTVEISDPEPSTENSQVQPDAV 316
                  .|:|: |.|      |....:|.|   .|..|...|...:.:|.     |:|:|     
Mouse   195 ------EVVREFYTH------IADQPDFEE---FVVSMTNGLSCVLIVSQ-----EDSEV----- 234

  Fly   317 HLAEIRSENVAEAEEETETEAEAGA--APEAKTAPVAAKR------------------------T 355
                |:.|.:    .:|:||.|.|.  .|..:.|||..|:                        .
Mouse   235 ----IQEETL----PQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAV 291

  Fly   356 KTIRIPPIWVPSDQRTHAALIYTYFRAQTTTFLPPDPVPEPPHIVMI------FDAYKKKDLAIL 414
            |..::..|..|..:...:..:.|     |...|.||...|....|:.      |....::.:.:.
Mouse   292 KVSKLIDILFPDFKTMKSTNVQT-----TLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLS 351

  Fly   415 LETCREDIPLY---GFFNGDNPLTAQFIAN-----SVEKYNAKPYVPTDKIVLKVNKVNSPTIPT 471
            .|..|....::   .:|  || |.....:|     ::.:.|...|..|        .:...||..
Mouse   352 EEEARTVCKIHENEEYF--DN-LIGHMTSNHSYVLALRRENGVEYWKT--------LIGPKTIEE 405

  Fly   472 LMAYGPSYVSANSVVGHQEATQFFPANYKSALQEEEELHAVKTEKPKKRKKNKKGGDPEESGKAD 536
            ..|..|..:......|:....||:.::.|:| .|:|..|..                |.:|..|.
Mouse   406 AYASHPQSLCVQFASGNFPTNQFYGSSSKAA-AEKEIAHFF----------------PPQSTLAL 453

  Fly   537 AGPADAQMEAEEAVKTSPEEGASTT 561
            ..|.....|..|.:||..|.|...|
Mouse   454 IKPHVTHKERMEILKTIKEAGFELT 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 35/107 (33%)
DUF4746 233..508 CDD:292550 58/315 (18%)
Nme8NP_853622.2 TRX_NDPK 11..113 CDD:239246 34/101 (34%)
NDPk 155..301 CDD:260363 39/240 (16%)
NDK 1 157..254 32/191 (17%)
NDK 2 312..452 32/172 (19%)
NDK 313..450 CDD:197791 31/169 (18%)
NDPk_TX 313..445 CDD:239879 30/148 (20%)
NDK 448..581 CDD:197791 10/31 (32%)
NDPk 448..579 CDD:260363 10/31 (32%)
NDK 3 453..586 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9301
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4604
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46135
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3807
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.