powered by:
Protein Alignment CG14221 and Nme9
DIOPT Version :9
Sequence 1: | NP_001259713.1 |
Gene: | CG14221 / 32961 |
FlyBaseID: | FBgn0031042 |
Length: | 586 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001159429.1 |
Gene: | Nme9 / 623534 |
MGIID: | 4359686 |
Length: | 263 |
Species: | Mus musculus |
Alignment Length: | 67 |
Identity: | 27/67 - (40%) |
Similarity: | 42/67 - (62%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 LQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYLKRFNKKSEPTWMFV 88
|...||.|:|:|..|||||..||...:|:::|:|.|.|..|..:|..:..|:::..|.|||::|.
Mouse 2 LGSKGLTVVDVYQGWCGPCKPMVSLFQKMRIEVGLDRLHFASAEADRLDVLEKYQGKCEPTFLFY 66
Fly 89 TS 90
|:
Mouse 67 TA 68
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
72 |
1.000 |
Domainoid score |
I9301 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0012576 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm43849 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR46135 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3807 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 6.100 |
|
Return to query results.
Submit another query.