DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and NME8

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_057700.3 Gene:NME8 / 51314 HGNCID:16473 Length:588 Species:Homo sapiens


Alignment Length:570 Identity:125/570 - (21%)
Similarity:210/570 - (36%) Gaps:153/570 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKKGGVQQLQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDN-LQLA 64
            ||.|....|||..:.:...:::.||..||.|:|:|..|||||..|....||:|.||..|. |..|
Human     1 MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFA 65

  Fly    65 ICKAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVP----KLVAMITRMLQSTMAKETHLSY 125
            :.:|.:|..|:.|..|.||.::|..:||.|..:.|.:.|    |::.:|....:....:.....|
Human    66 VAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQY 130

  Fly   126 EITELQPIELEQLEVRNKALRLAEEIELAESRRKRLEYLHSVTDCIMANLPDIGITVFGPQVNRD 190
            ....|...:.|..|               ||..:.::.|:|:  .|:.  ||..|:         
Human   131 PEIPLVDSDSEVSE---------------ESPCESVQELYSI--AIIK--PDAVIS--------- 167

  Fly   191 MFKKLSEPADPLKIQCKDRKVFTILPSDIATVNFAAENPLSPEVIEQLYDKELLMCFWKVDEVLG 255
              ||:      |:|:.|..|...|:.::..||       |:.|.:...|.:....|  ..:|.:.
Human   168 --KKV------LEIKRKITKAGFIIEAEHKTV-------LTEEQVVNFYSRIADQC--DFEEFVS 215

  Fly   256 TPPTVLRQYAHELTKETIKPPDEFNEEEITVPPMIVPLEVTVEISDPEPSTENSQVQP------- 313
            ...:.|.............||.|..|.:....|.        |.|:.:|..| :||.|       
Human   216 FMTSGLSYILVVSQGSKHNPPSEETEPQTDTEPN--------ERSEDQPEVE-AQVTPGMMKNKQ 271

  Fly   314 -------DAVHLAEIRSENVAEAEEETETEAEAGAA--PEAKTAPVAAKRTKTIRIPPIWVPSDQ 369
                   :..|||::     .:.||:....|:...|  |:       .|:.|::::        :
Human   272 DSLQEYLERQHLAQL-----CDIEEDAANVAKFMDAFFPD-------FKKMKSMKL--------E 316

  Fly   370 RTHAALIYTYFRAQTTTFL-----PPDPVPEPPHIVMIFDAYKKKDLAILLETCREDIPLYGFFN 429
            :|.|.|....|..:....|     ....:.|...:|:    .:|:..|:..|...||     :||
Human   317 KTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVL----SEKEAQALCKEYENED-----YFN 372

  Fly   430 GDNPLTAQFIANSVEKYNAKPYVPTDKIVLKVN------KVNSP-TIPTLMAYGPSYVSA----- 482
                       ..:|...:.|.:..  ::|:.|      ::..| |:...:.|.|..:.|     
Human   373 -----------KLIENMTSGPSLAL--VLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQFAMD 424

  Fly   483 ----NSVVG-------HQEATQFFPAN--------YKSALQEEEELHAVK 513
                |.:.|       .:|...|||..        :.::.|.|:.|..||
Human   425 SLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVK 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 37/104 (36%)
DUF4746 233..508 CDD:292550 58/326 (18%)
NME8NP_057700.3 TRX_NDPK 11..113 CDD:239246 36/101 (36%)
NDPk_TX 154..304 CDD:239879 40/193 (21%)
NDK 1 157..257 26/137 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..261 9/39 (23%)
NDK 2 315..455 29/169 (17%)
NDK 316..453 CDD:197791 29/158 (18%)
NDPk_TX 316..448 CDD:239879 26/153 (17%)
NDK 451..586 CDD:197791 5/24 (21%)
NDPk_TX 451..582 CDD:239879 5/24 (21%)
NDK 3 456..588 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9549
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46135
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3807
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.