DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and txnl1

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001006844.1 Gene:txnl1 / 448593 XenbaseID:XB-GENE-965625 Length:289 Species:Xenopus tropicalis


Alignment Length:319 Identity:60/319 - (18%)
Similarity:115/319 - (36%) Gaps:86/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSL--------RKIKLELGGDNLQLAICKA 68
            :.:|.||:..|..:|  |.|:....:.|.||:.:..:.        :.|.||:.....| |...|
 Frog     7 IGADGEFQGDLTAAGSRLSVVKFTMKGCAPCVRIAPAFTSLSNKYPQAIFLEVDVHQCQ-ATATA 70

  Fly    69 GSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEITELQPI 133
            .:||        :.||::|..:...|:...|.|...|...|.:.|::.....             
 Frog    71 NNIS--------ATPTFLFFRNKVKIDQYQGADAAGLEDKIKQHLENDPGNN------------- 114

  Fly   134 ELEQLEVRNKALRLAEEIELAESRRKRLEYLHSV-TDCIMANLPDIGITVFGPQVNRDMFKKLSE 197
                           |:.::.......|.::|.. .:|:..: .|.|.        .:..:|   
 Frog   115 ---------------EDADIPRGYMDLLPFVHKAGCECLNES-DDHGF--------ENCLRK--- 152

  Fly   198 PADP--LKIQCKDRKVFTIL---PSDIATVNF-AAENPLSPEVIEQLYDKELLMCFWKVDEVLGT 256
              ||  |:..|.::.:.|:.   |..:.::.. ..:|...|:.::...:....|.|   ||.:.:
 Frog   153 --DPTYLESDCDEQLLMTVAFSQPVKLYSMKLQGPDNGQGPKYVKIFINLPRSMDF---DEAMRS 212

  Fly   257 PPTVLRQYAHELTKETIKPPDEFNEEEITVPPMIVPLE----VTVEISDPEPSTENSQV 311
            .||    .|.||:.:.||       |:..||...|..:    ||:.:...:...|.:::
 Frog   213 EPT----QAVELSADDIK-------EDSIVPLRYVKFQNVNSVTLFVQSNQGDEEATRI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 26/106 (25%)
DUF4746 233..508 CDD:292550 18/83 (22%)
txnl1NP_001006844.1 TRX_family 12..104 CDD:239245 24/100 (24%)
PITH 126..268 CDD:368787 32/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.