DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and txn2

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_991204.1 Gene:txn2 / 402938 ZFINID:ZDB-GENE-040426-1795 Length:166 Species:Danio rerio


Alignment Length:110 Identity:24/110 - (21%)
Similarity:44/110 - (40%) Gaps:32/110 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICK-AGSISYLK----- 75
            |:..|:.:.....:::|.:::|||||            ::.|..|:.||.| .|.::..|     
Zfish    67 DDFTERVINSELPVLIDFHAQWCGPC------------KILGPRLEKAIAKQKGRVTMAKVDIDE 119

  Fly    76 ------RFNKKSEPTWMFVTSGKAINIMFG--------TDVPKLV 106
                  .:...:.||.:.:..|..|:...|        |.|.||:
Zfish   120 HTDLAIEYGVSAVPTVIAMRGGDVIDQFVGIKDEDQLDTFVEKLI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 24/110 (22%)
DUF4746 233..508 CDD:292550
txn2NP_991204.1 TRX_family 67..161 CDD:239245 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.