DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and Pdi

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster


Alignment Length:561 Identity:104/561 - (18%)
Similarity:193/561 - (34%) Gaps:153/561 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKA-----GSISY 73
            :|:.:.|::.:..:..::::.|:.|||.|..:.....|...:|......:.:.|.     |.:: 
  Fly    31 VATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELA- 94

  Fly    74 LKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEITELQPIE--LE 136
             :::..:..||..|..||..:....|.....::|.:|:       |....:.::|.:...|  |:
  Fly    95 -EQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTK-------KTGPPAKDLTSVADAEQFLK 151

  Fly   137 QLEVRNKALRLAEEIELAESRRKRLEYLHSVTDCIMANLPDIGITVFGPQVNRDMFKKLSEPADP 201
            ..|:  ..:...:::|..|::          |...:||..|  ..|||...|.|:.         
  Fly   152 DNEI--AIIGFFKDLESEEAK----------TFTKVANALD--SFVFGVSSNADVI--------- 193

  Fly   202 LKIQCKDRKVFTILPSDIATVNFAAENPLSPEVIEQLYDKELLMCFWKVDEVLGTPPTVLRQYAH 266
            .|.:.||..|....|.|.           ...|.|...::|.|..|.:|..:    |.:: .:.|
  Fly   194 AKYEAKDNGVVLFKPFDD-----------KKSVFEGELNEENLKKFAQVQSL----PLIV-DFNH 242

  Fly   267 ELTKE----TIKPPDEF--NEEEITVPPMIVPLE------------VTVEISDPEPSTE------ 307
            |...:    :||....|  :.|...:...:.||:            ||:. ||.|..|.      
  Fly   243 ESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTIS-SDEEDHTRIFEFFG 306

  Fly   308 -NSQVQPDAVHLAEIRSENVAEAEEETETEAEAGAAPEAKTAPVAAKRTKTIRIPPIWVPSDQRT 371
             |.:..| .:.|.::..:......|..:..||                                |
  Fly   307 MNKEEVP-TIRLIKLEEDMAKYKPESDDLSAE--------------------------------T 338

  Fly   372 HAALIYTYFRAQTTTFLPPDPVPEP----PHIVMIFDAYKK----KDLAILLE-------TCRED 421
            ..|.:..:...:....|....:||.    |..|::...::.    |..::|:|       .|::.
  Fly   339 IEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQL 403

  Fly   422 IPLYG-----FFNGDNPLTAQF--IANSVEKYNAKPYVPTDKIVLKV-NKVNSPTIPTLMAYGPS 478
            .|:|.     :.:.::.:.|:.  .||.:|......: ||.|...|. |||....:...:.....
  Fly   404 APIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSF-PTIKYFRKEDNKVIDFNLDRTLDDFVK 467

  Fly   479 YVSANSVVGHQEATQFFPANYKSALQEEEELHAVKTEKPKK 519
            ::.||..|...|..:         ..||||      |.|||
  Fly   468 FLDANGEVADSEPVE---------ETEEEE------EAPKK 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 18/101 (18%)
DUF4746 233..508 CDD:292550 57/322 (18%)
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 94/525 (18%)
pdi_dom 33..133 CDD:273454 18/108 (17%)
PDI_b_family 137..231 CDD:239279 26/127 (20%)
PDI_b'_family 244..347 CDD:239280 20/136 (15%)
PDI_a_PDI_a'_C 368..469 CDD:239293 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.