DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and CG13473

DIOPT Version :10

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_648717.1 Gene:CG13473 / 39603 FlyBaseID:FBgn0036442 Length:139 Species:Drosophila melanogaster


Alignment Length:115 Identity:25/115 - (21%)
Similarity:54/115 - (46%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SDEEFEKFLQRSG---LLVLDIYSEWCGPCLGMVG-SLRKIKLELGGDNLQLAICKAGSISYLKR 76
            |...|:|.:..:|   .::::.::.||||| .|:| .|.::..:..|..|.|.|....:.....:
  Fly    13 SKSYFDKLIDDAGTNKYVLVEFFATWCGPC-AMIGPRLEQLASDYFGRMLVLKIDVDENEDLAVQ 76

  Fly    77 FNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYE 126
            :...|.||::.:.:...:....|.:|.::|:.:.:.:......:.|.|.|
  Fly    77 YEVNSMPTFLIIKNRVTLIQFVGGNVERVVSTVEKFVGKVEDSKEHKSKE 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 11..111 CDD:469754 22/98 (22%)
DUF4746 233..508 CDD:435025
CG13473NP_648717.1 CnoX 7..99 CDD:442352 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.