DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and Txl

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster


Alignment Length:240 Identity:58/240 - (24%)
Similarity:96/240 - (40%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSL--------RKIKLELGGDNLQLAICKAGSI 71
            :..|:..|.::|  |:|:|..:.|||||..:....        :.|.|::..|..|......| :
  Fly     9 ESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQG-V 72

  Fly    72 SYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSY--EITELQP-I 133
            |.:        ||::|..:...|:.:.|.||..|.|.|...:.::..:|....|  .:.||.. |
  Fly    73 SAM--------PTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDYGQGLMELNTFI 129

  Fly   134 ELEQLEVRNKALRLAEEIELAESRRKRLEYLHSVTDCIMANLPDIGITVFGPQVNRDMFKKLSEP 198
            ..::.|..|:    |::..|..:......||.|  ||....:  :.|| |...|.....|..:  
  Fly   130 SKQECECLNE----ADDHNLKHALASAGGYLQS--DCDEQLI--LSIT-FNQAVKIHSLKFKA-- 183

  Fly   199 ADPLKIQCKDRKVFTILPSDIATVNFAAENPLSPEVIEQLYDKEL 243
              |..:..||.|:|...|   .|::|.....::......|..|||
  Fly   184 --PSHLGPKDVKLFINQP---RTIDFDMAESMNSVQDLSLAQKEL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 27/103 (26%)
DUF4746 233..508 CDD:292550 4/11 (36%)
TxlNP_523938.2 TRX_family 10..103 CDD:239245 26/101 (26%)
PITH 125..266 CDD:283785 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.