DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and Txndc8

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001004092.1 Gene:Txndc8 / 362525 RGDID:1303121 Length:127 Species:Rattus norvegicus


Alignment Length:143 Identity:35/143 - (24%)
Similarity:66/143 - (46%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VQQLQADLASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAG 69
            ||:::    |..||::.|..:|  |:|::..::|||||..:..:.:.:.|:.  .|:..|.....
  Rat     2 VQKIK----SMREFKELLGAAGNRLVVVEFSAQWCGPCKMIAPAFQAMSLQY--RNVMFAQVDVD 60

  Fly    70 SISYL-KRFNKKSEPTW-MFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEITELQP 132
            |...| :..:.:..||: ||..|.|.      |...:|..::........:|      :|.|.|.
  Rat    61 SSQELTEHCSIQVVPTFQMFKHSRKV------TPFSRLKRILCCFRSGPGSK------KIFEFQG 113

  Fly   133 IELEQLEVRNKAL 145
            .::|:||.:.:.|
  Rat   114 ADIEKLEEKIQEL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 25/103 (24%)
DUF4746 233..508 CDD:292550
Txndc8NP_001004092.1 Thioredoxin_like 1..89 CDD:412351 26/98 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350601
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.