DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and NME9

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:XP_016861795.1 Gene:NME9 / 347736 HGNCID:21343 Length:353 Species:Homo sapiens


Alignment Length:165 Identity:48/165 - (29%)
Similarity:84/165 - (50%) Gaps:36/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LQADLASDEEFEKFLQRSGLLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYL 74
            ||.::::.|.:|:.|...||.|:|:|..|||||..:|...:|:::|:|.|.|..|:.:|..:..|
Human    22 LQVNISTQELWEEMLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVL 86

  Fly    75 KRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRMLQSTMAKETHLSYEITELQPIELEQLE 139
            :::..|.|||::|...|:.:.::.|.:.|        :||.|:                 |:|||
Human    87 EKYRGKCEPTFLFYAGGELVAVVRGANAP--------LLQKTI-----------------LDQLE 126

  Fly   140 VRNKALRLAEEIELAESRRKRL---EYLHSVTDCI 171
                    ||:..|||.|.:::   |.|....:|:
Human   127 --------AEKKVLAEGRERKVIKDEALSDEDECV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 31/99 (31%)
DUF4746 233..508 CDD:292550
NME9XP_016861795.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I9549
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4604
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41797
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46135
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3807
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.