DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and Trx-2

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster


Alignment Length:104 Identity:29/104 - (27%)
Similarity:52/104 - (50%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QADLASDEEFEKFLQRSG-LLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAI----CKAGS 70
            :|||  |.:..|   .|| |:|||.::.|||||..:...|.::..:...:.:.|.:    |:..:
  Fly     8 KADL--DGQLTK---ASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIA 67

  Fly    71 ISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMI 109
            :.|    |..|.||::|:.:|..:....|.:..:|..:|
  Fly    68 MEY----NISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 29/104 (28%)
DUF4746 233..508 CDD:292550
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464330
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.