Sequence 1: | NP_001259713.1 | Gene: | CG14221 / 32961 | FlyBaseID: | FBgn0031042 | Length: | 586 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956317.1 | Gene: | zgc:56493 / 336637 | ZFINID: | ZDB-GENE-030131-8581 | Length: | 108 | Species: | Danio rerio |
Alignment Length: | 108 | Identity: | 26/108 - (24%) |
---|---|---|---|
Similarity: | 49/108 - (45%) | Gaps: | 21/108 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKIK----------LELGGDNLQLAIC 66
Fly 67 KAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMI 109 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14221 | NP_001259713.1 | Thioredoxin_like | 11..111 | CDD:294274 | 26/108 (24%) |
DUF4746 | 233..508 | CDD:292550 | |||
zgc:56493 | NP_956317.1 | TRX_family | 11..104 | CDD:239245 | 26/102 (25%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0907 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1482186at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |