DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and txna

DIOPT Version :10

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_956317.1 Gene:txna / 336637 ZFINID:ZDB-GENE-030131-8581 Length:108 Species:Danio rerio


Alignment Length:108 Identity:26/108 - (24%)
Similarity:49/108 - (45%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKIK----------LELGGDNLQLAIC 66
            :...:.|:|.|..:|  |:|:|..:.|||||..:....:.:.          |::..|:.| .:.
Zfish     5 IEDQDGFDKALAGAGDKLVVVDFTATWCGPCQSIAPFYKGLSENPDYSNVVFLKVDVDDAQ-DVA 68

  Fly    67 KAGSISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMI 109
            ::..|        |..||:.|..:||.::...|::..||..|:
Zfish    69 QSCEI--------KCMPTFHFYKNGKKLDDFSGSNQTKLEEMV 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 11..111 CDD:469754 26/108 (24%)
DUF4746 233..508 CDD:435025
txnaNP_956317.1 TRX_family 11..104 CDD:239245 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.