DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and trx2

DIOPT Version :10

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07C Length:133 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:20/82 - (24%)
Similarity:38/82 - (46%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLAICKAGSISYLKRFN-KKSEPTWMFVTSGKAI 94
            |:|.|::|||||..:...|.|:..:  ..........|...|.:.:.| ..:.||.:....|:.:
pombe    51 VVDFYADWCGPCKYLKPFLEKLSEQ--NQKASFIAVNADKFSDIAQKNGVYALPTMVLFRKGQEL 113

  Fly    95 NIMFGTDVPKLVAMITR 111
            :.:.|.||..|.:::.:
pombe   114 DRIVGADVKTLSSLLAK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 11..111 CDD:469754 20/80 (25%)
DUF4746 233..508 CDD:435025
trx2NP_595954.2 TRX_family 39..122 CDD:239245 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.