DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14221 and XB5961763

DIOPT Version :9

Sequence 1:NP_001259713.1 Gene:CG14221 / 32961 FlyBaseID:FBgn0031042 Length:586 Species:Drosophila melanogaster
Sequence 2:NP_001123676.1 Gene:XB5961763 / 100170428 XenbaseID:XB-GENE-5961764 Length:104 Species:Xenopus tropicalis


Alignment Length:107 Identity:25/107 - (23%)
Similarity:43/107 - (40%) Gaps:16/107 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LASDEEFEKFLQRSG--LLVLDIYSEWCGPCLGMVGSLRKIKLELGGDNLQLA------ICKAGS 70
            |.|.||.:..|:.:|  |::::..|..||.|..:.....|:..|.....|...      :|:...
 Frog     5 LRSVEELQYALRDAGQKLVLVNFSSHKCGQCTIVAPEYEKLCTEYPDILLYKVLDDAPKLCQHCE 69

  Fly    71 ISYLKRFNKKSEPTWMFVTSGKAINIMFGTDVPKLVAMITRM 112
            |:        |.||::|......|....|.|:.:|...|.::
 Frog    70 IT--------STPTFLFYKDRLKIKQFSGADIVQLRETIRKL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14221NP_001259713.1 Thioredoxin_like 11..111 CDD:294274 25/104 (24%)
DUF4746 233..508 CDD:292550
XB5961763NP_001123676.1 TRX_family 9..100 CDD:239245 22/98 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.