DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14210 and CCDC86

DIOPT Version :9

Sequence 1:NP_001285449.1 Gene:CG14210 / 32958 FlyBaseID:FBgn0031040 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_077003.1 Gene:CCDC86 / 79080 HGNCID:28359 Length:360 Species:Homo sapiens


Alignment Length:143 Identity:63/143 - (44%)
Similarity:91/143 - (63%) Gaps:14/143 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 APETVPAKKPAKAKK-------AAKPENS-----IPRGQPKSNRPWK-TPKQKFSK-IKKTVNRL 55
            |.|||.....||.:|       |:|..|.     ||:|:|||.|.|| ..|::||: ::....|.
Human   201 AGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRT 265

  Fly    56 SFEKKTALRDELRYIKERSKEIKDKRKEDAVQKHQRRVENAERRLANERRSEVVQVIKNPAKLKR 120
            |:::|...|.|.:..|:.::.::::::....:|.|||.||.:|||.|||::||||||:|||||||
Human   266 SWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKR 330

  Fly   121 MKKKQMRMIEKRD 133
            .||||:|.|||||
Human   331 AKKKQLRSIEKRD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14210NP_001285449.1 Cgr1 28..127 CDD:397798 46/100 (46%)
CCDC86NP_077003.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..313 37/111 (33%)
MCLC <56..201 CDD:283562 63/143 (44%)
Cgr1 236..338 CDD:281823 46/101 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..360 13/16 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149578
Domainoid 1 1.000 89 1.000 Domainoid score I7894
eggNOG 1 0.900 - - E1_KOG4538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008319
OrthoInspector 1 1.000 - - oto88735
orthoMCL 1 0.900 - - OOG6_106069
Panther 1 1.100 - - LDO PTHR13557
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6302
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.700

Return to query results.
Submit another query.