DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14210 and Ccdc86

DIOPT Version :9

Sequence 1:NP_001285449.1 Gene:CG14210 / 32958 FlyBaseID:FBgn0031040 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001006975.1 Gene:Ccdc86 / 293738 RGDID:1359280 Length:341 Species:Rattus norvegicus


Alignment Length:128 Identity:56/128 - (43%)
Similarity:85/128 - (66%) Gaps:3/128 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VPAKKPAKAKKAAKPE-NSIPRGQPKSNRPWK-TPKQKFSK-IKKTVNRLSFEKKTALRDELRYI 70
            |.|...|.|.|..|.| ..||:|:|||.|.|| ..|::||: ::....|.|:::|...|.|.:..
  Rat   197 VIASPQAPASKKLKEELPVIPKGKPKSGRVWKDRSKKRFSQMVQDKPLRTSWQRKMKERQERKLA 261

  Fly    71 KERSKEIKDKRKEDAVQKHQRRVENAERRLANERRSEVVQVIKNPAKLKRMKKKQMRMIEKRD 133
            |:.::.::::::....:|.:||.||..|||.|||::|:||||:||||||:.||||:|.|:|||
  Rat   262 KDFARHLEEEKQRRRQEKKERRAENLRRRLENERKAEIVQVIRNPAKLKKAKKKQLRSIQKRD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14210NP_001285449.1 Cgr1 28..127 CDD:397798 43/100 (43%)
Ccdc86NP_001006975.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..341 56/128 (44%)
Cgr1 217..303 CDD:281823 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343462
Domainoid 1 1.000 86 1.000 Domainoid score I7943
eggNOG 1 0.900 - - E1_KOG4538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008319
OrthoInspector 1 1.000 - - oto95870
orthoMCL 1 0.900 - - OOG6_106069
Panther 1 1.100 - - LDO PTHR13557
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6302
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.700

Return to query results.
Submit another query.