DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14210 and Y40B1B.7

DIOPT Version :9

Sequence 1:NP_001285449.1 Gene:CG14210 / 32958 FlyBaseID:FBgn0031040 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_493363.1 Gene:Y40B1B.7 / 173211 WormBaseID:WBGene00012739 Length:123 Species:Caenorhabditis elegans


Alignment Length:107 Identity:44/107 - (41%)
Similarity:71/107 - (66%) Gaps:2/107 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KSNRPWKTPKQ-KFSKIKKTVN-RLSFEKKTALRDELRYIKERSKEIKDKRKEDAVQKHQRRVEN 95
            ||||.|||.:: |.|:|||... :.:::||..|:.:...:|.....|::|:.::..:|.:|:||.
 Worm    15 KSNRWWKTKQEKKHSEIKKVKTLKSTWDKKMELKAKKDMVKRVQDNIREKQVQERQEKKERKVEQ 79

  Fly    96 AERRLANERRSEVVQVIKNPAKLKRMKKKQMRMIEKRDVSQV 137
            .:|||.|||::|:||.|....|||:.||:|:|.|:.||.:||
 Worm    80 EKRRLENERKAEIVQKITKIHKLKKTKKRQLRSIQMRDTTQV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14210NP_001285449.1 Cgr1 28..127 CDD:397798 38/95 (40%)
Y40B1B.7NP_493363.1 Cgr1 14..96 CDD:281823 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161032
Domainoid 1 1.000 71 1.000 Domainoid score I6172
eggNOG 1 0.900 - - E1_KOG4538
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3785
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49467
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19582
orthoMCL 1 0.900 - - OOG6_106069
Panther 1 1.100 - - LDO PTHR13557
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.