DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14210 and Ccdc86

DIOPT Version :9

Sequence 1:NP_001285449.1 Gene:CG14210 / 32958 FlyBaseID:FBgn0031040 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_076220.2 Gene:Ccdc86 / 108673 MGIID:1277220 Length:426 Species:Mus musculus


Alignment Length:142 Identity:59/142 - (41%)
Similarity:90/142 - (63%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ESAPETVPAKK--------PAKAKKAAKPE-NSIPRGQPKSNRPWK-TPKQKFSK-IKKTVNRLS 56
            |:..|::..||        ||..|...|.| ..||:|:|||.|.|| ..|::||: ::....|.|
Mouse   268 ETVTESLNLKKRVIASPQAPASKKLKEKEELPVIPKGKPKSGRVWKDRSKKRFSQMVQDKPLRTS 332

  Fly    57 FEKKTALRDELRYIKERSKEIKDKRKEDAVQKHQRRVENAERRLANERRSEVVQVIKNPAKLKRM 121
            :::|...|.|.:..|:.::.::::::....:|.:||.||..|||.|||::|:||||:||||||:.
Mouse   333 WQRKMKERQERKLAKDFARHLEEEKQRRRQEKKERRAENLRRRLENERKAEIVQVIRNPAKLKKA 397

  Fly   122 KKKQMRMIEKRD 133
            ||||:|.|||||
Mouse   398 KKKQLRSIEKRD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14210NP_001285449.1 Cgr1 28..127 CDD:397798 43/100 (43%)
Ccdc86NP_076220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..426 59/142 (42%)
Cgr1 302..388 CDD:281823 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839640
Domainoid 1 1.000 86 1.000 Domainoid score I8134
eggNOG 1 0.900 - - E1_KOG4538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008319
OrthoInspector 1 1.000 - - oto92304
orthoMCL 1 0.900 - - OOG6_106069
Panther 1 1.100 - - LDO PTHR13557
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4445
SonicParanoid 1 1.000 - - X6302
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.