DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and ibpA

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_418142.1 Gene:ibpA / 948200 ECOCYCID:EG11534 Length:137 Species:Escherichia coli


Alignment Length:99 Identity:23/99 - (23%)
Similarity:45/99 - (45%) Gaps:17/99 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 DNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKH-EEKSDTKSVY-----REYNREFLLPKGVNP 158
            |....::...|:.:|..|:.:...|..|:|...| :|:.:...:|     |.:.|:|.|.:.:: 
E. coli    43 DENHYRIAIAVAGFAESELEITAQDNLLVVKGAHADEQKERTYLYQGIAERNFERKFQLAENIH- 106

  Fly   159 ESIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK 192
              :|.:...:|:|.:|.        |.:||.|.|
E. coli   107 --VRGANLVNGLLYIDL--------ERVIPEAKK 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 18/82 (22%)
ibpANP_418142.1 PRK10743 1..137 CDD:182691 23/99 (23%)

Return to query results.
Submit another query.