DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and ibpB

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_418141.2 Gene:ibpB / 948192 ECOCYCID:EG11535 Length:142 Species:Escherichia coli


Alignment Length:84 Identity:11/84 - (13%)
Similarity:37/84 - (44%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS------VYREYNREFLLPKG 155
            ::.|:...::...::.:..|::.::....:|.|....|:..:.|.      :.:.::..|.|.:.
E. coli    38 EKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAEN 102

  Fly   156 VNPESIRSSLSKDGVLTVD 174
            :   .:..:...:|:|.:|
E. coli   103 M---EVSGATFVNGLLHID 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 11/84 (13%)
ibpBNP_418141.2 PRK11597 1..142 CDD:183223 11/84 (13%)

Return to query results.
Submit another query.