DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and HSPB9

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 / 94086 HGNCID:30589 Length:159 Species:Homo sapiens


Alignment Length:153 Identity:39/153 - (25%)
Similarity:68/153 - (44%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MNREANFFESTSSTKKTTTTSSTTNSALPSRIPK----QQNYVSDI------SSPLIQDEGDN-- 101
            |.|..|.|              :..|.:.||.|.    ::|.|:.:      .||..|::.|:  
Human     1 MQRVGNTF--------------SNESRVASRCPSVGLAERNRVATMPVRLLRDSPAAQEDNDHAR 51

  Fly   102 KVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHE-EKSDTKSV-YR---EYNREFLLPKGVNPESI 161
            ...:::.|...:||||:||:...|.|:|..:.: :..|.:.| ||   :.:|: :||..::|.::
Human    52 DGFQMKLDAHGFAPEELVVQVDGQWLMVTGQQQLDVRDPERVSYRMSQKVHRK-MLPSNLSPTAM 115

  Fly   162 RSSLSKDGVLTVDAPLPALTAGE 184
            ...|:..|.|.|.....||...|
Human   116 TCCLTPSGQLWVRGQCVALALPE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 24/87 (28%)
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148945
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.