DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and AT1G52560

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 / 841687 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana


Alignment Length:114 Identity:28/114 - (24%)
Similarity:42/114 - (36%) Gaps:30/114 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RDLSLACVADVYSC---DCLRVSIDTKSGASSVDR---------------MPSATDQCGFFNATC 191
            :|:.|....||.||   :...||..::|...:..:               |||..|....:|||.
plant   443 KDIDLVSEKDVVSCPSNEATDVSTQSESNKGTQTKKIGRKMNNSKEKNRGMPSIVDIFKNYNATP 507

  Fly   192 -----SEDDYTPFLHSSTSSFIFSQGTRHFKSVSYEDLLCVKEKETFDW 235
                 :::|.|.   ||.|.......:.|...|:.|    |:|....||
plant   508 PSKQETQEDSTV---SSASKRAKLSSSSHNSQVNQE----VEESRETDW 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 9/49 (18%)
AT1G52560NP_175665.1 IbpA 126..232 CDD:439841
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.