DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and AT1G07400

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:135 Identity:35/135 - (25%)
Similarity:61/135 - (45%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 REANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAP 115
            :|..|..|.|.     .||:.||    :|:..::...:.:               .:.|:.....
plant    30 KELQFPSSLSG-----ETSAITN----ARVDWKETAEAHV---------------FKADLPGMKK 70

  Fly   116 EEIVVKTVDQKLLV-----HAKHEEKSDT-KSVYR---EYNREFLLPKGVNPESIRSSLSKDGVL 171
            ||:.|:..|..:|.     |.:.|||.|| ..|.|   :::|:|.||:.|..:.:::|: ::|||
plant    71 EEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQFSRKFKLPENVKMDQVKASM-ENGVL 134

  Fly   172 TVDAP 176
            ||..|
plant   135 TVTVP 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 26/90 (29%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.