DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and AT2G19310

DIOPT Version :10

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:112 Identity:29/112 - (25%)
Similarity:42/112 - (37%) Gaps:34/112 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELMNREANF----------FESTSSTKKTTTTSSTTNSALP-SRIPKQ---QNYVSDISSPLIQD 97
            ||||...:|          |.|.|......|:|||.|:.|. :..|..   :.|:..:.    ||
plant    23 ELMNTFLDFPSPALFLSHHFPSLSREIFPQTSSSTVNTQLNWTETPTAHVFKAYLPGVD----QD 83

  Fly    98 E---------------GDNKVLKLRFDVSQYAPEEIVVKTVDQKLLV 129
            |               ||||.:. ||.:...|..:.|...::.:.||
plant    84 EVIAFVDEEGYLQICTGDNKFMS-RFKLPNNALTDQVTAWMEDEFLV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 13/49 (27%)
AT2G19310NP_179521.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..134 CDD:469641 16/74 (22%)

Return to query results.
Submit another query.