DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and AT2G19310

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:112 Identity:29/112 - (25%)
Similarity:42/112 - (37%) Gaps:34/112 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ELMNREANF----------FESTSSTKKTTTTSSTTNSALP-SRIPKQ---QNYVSDISSPLIQD 97
            ||||...:|          |.|.|......|:|||.|:.|. :..|..   :.|:..:.    ||
plant    23 ELMNTFLDFPSPALFLSHHFPSLSREIFPQTSSSTVNTQLNWTETPTAHVFKAYLPGVD----QD 83

  Fly    98 E---------------GDNKVLKLRFDVSQYAPEEIVVKTVDQKLLV 129
            |               ||||.:. ||.:...|..:.|...::.:.||
plant    84 EVIAFVDEEGYLQICTGDNKFMS-RFKLPNNALTDQVTAWMEDEFLV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 13/49 (27%)
AT2G19310NP_179521.1 alpha-crystallin-Hsps_p23-like 61..134 CDD:381838 16/74 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.