DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hspb11

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001092897.1 Gene:hspb11 / 796767 ZFINID:ZDB-GENE-030131-5148 Length:205 Species:Danio rerio


Alignment Length:176 Identity:58/176 - (32%)
Similarity:87/176 - (49%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RFDSEMRKMEEEMAKFRH--ELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDIS 91
            :|:.||.:..:||   ||  |.|.|                        |..||..:.::||.::
Zfish    34 QFEQEMMRHMQEM---RHNMEFMER------------------------LHQRIFDEIDHVSPMT 71

  Fly    92 S--PL---IQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDT-KSVY----REY 146
            :  |:   :..||.:..|.|  |...::|||:.||.|.:||.|..|.|:|.|. |..|    :|:
Zfish    72 TFKPISFQLGKEGSHYALTL--DTQDFSPEELAVKQVGRKLRVSGKTEKKQDDGKGSYSYRCQEF 134

  Fly   147 NREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALT-AGETLIPIAH 191
            .:||.||:||||||:..||: :|.|.:.||....| :.|.:|||.:
Zfish   135 RQEFDLPEGVNPESVSCSLN-NGQLQIQAPREGNTVSNERVIPITY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 36/85 (42%)
hspb11NP_001092897.1 IbpA 36..177 CDD:223149 55/170 (32%)
ACD_HspB9_like 81..164 CDD:107236 36/85 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582867
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.