DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hspb3

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:163 Identity:41/163 - (25%)
Similarity:70/163 - (42%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IRERFDSEMRKMEE------EMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALPSRIPKQQ 84
            :|...::.:|..||      |..:..|.|........|.....:.|               ||..
  Rat     6 LRHLIETPVRYQEEFEARGLEDCRLDHALYALPGPTIEDLRKARGT---------------PKAL 55

  Fly    85 NYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKS-VYREYNR 148
            ...|| |:.....||.:: .::..||.|:.||:|:::|.:..||:.|:|..:.|... :.|.:.|
  Rat    56 AEDSD-SAETPPGEGKSR-FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTR 118

  Fly   149 EFLLPKGVNPESIRSSLSKDGVLTVDAPLPALT 181
            ::.||.||..:.:.:.|..||:|.|:...|..|
  Rat   119 QYKLPDGVETKDLSAILCHDGILVVEVKDPLET 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 25/81 (31%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 6/36 (17%)
ACD_HspB3_Like 65..147 CDD:107232 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.