DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hspb1

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:139 Identity:53/139 - (38%)
Similarity:75/139 - (53%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ESTSSTKKTTTTSSTT---NSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFDVSQYAPEEI 118
            :|......||...:|.   |.||..::.      |.||.  |:...|.  .|:..||:.:||||:
 Frog    61 QSMEVVPPTTPAGATAPDFNRALSRQLS------SGISE--IRQTSDQ--WKISLDVNHFAPEEL 115

  Fly   119 VVKTVDQKLLVHAKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPL--PAL 180
            |:||.|..:.:..|||||.|... :.|.:.|::.||.||:...:.||||.||:|||:|||  ||:
 Frog   116 VIKTKDGIVEITGKHEEKQDEHGFISRCFTRKYTLPPGVDINKVASSLSPDGILTVEAPLPKPAI 180

  Fly   181 TAGETLIPI 189
            .:.|..|||
 Frog   181 QSAEIAIPI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 34/81 (42%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 37/88 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.