DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and Hspb9

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_083583.2 Gene:Hspb9 / 75482 MGIID:1922732 Length:168 Species:Mus musculus


Alignment Length:146 Identity:36/146 - (24%)
Similarity:66/146 - (45%) Gaps:15/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 STSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDE-----GDNKVLKLRFDVSQYAPEE 117
            |:.||.:.....:...|..||....::|.|:.:...|::||     .:....:::.|...:|||:
Mouse     6 SSFSTGQREPGENRVASRCPSVALAERNQVATLPVRLLRDEVQGNGCEQPSFQIKVDAQGFAPED 70

  Fly   118 IVVKTVDQKLLV--HAKHEEKSDTKSVYR---EYNREFLLPKGVNPESIRSSLSKDGVLTVDA-- 175
            :||:...|.|.|  ..:||....::..||   ..:|:..||..::|.::..||:..|.|.:..  
Mouse    71 LVVRIDGQNLTVTGQRQHESNDPSRGRYRMEQSVHRQMQLPPTLDPAAMTCSLTPSGHLWLRGQN 135

  Fly   176 ---PLPALTAGETLIP 188
               |.|....|::..|
Mouse   136 KCLPPPEAQTGQSQKP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 23/95 (24%)
Hspb9NP_083583.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 4/18 (22%)
ACD_HspB9_like 50..135 CDD:107236 21/84 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 83..104 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..168 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.