DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and hspb7

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:140 Identity:38/140 - (27%)
Similarity:67/140 - (47%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 REANFFESTSSTKKTTTTSSTTNSALPSRIPKQQNYVSDISSPLIQDE-----------GDNKVL 104
            |....:..|||     ::||::.||.|.....:..:..|..|.:...:           |:.|.|
Zfish    10 RSERSYHQTSS-----SSSSSSTSANPYMEKSRGLFADDFGSFMCPKDALGFPNRTGTVGNIKTL 69

  Fly   105 ----KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSL 165
                :...||..::||:::|.|.:.::.|||  |:.:...:|...:..:..||:.|:|.|::|||
Zfish    70 GDTYQFTVDVQDFSPEDVIVTTSNNQIEVHA--EKLASDGTVMNTFTHKCRLPEDVDPTSVKSSL 132

  Fly   166 SKDGVLTVDA 175
            ..||.||:.|
Zfish   133 GADGTLTIKA 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 27/95 (28%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 27/81 (33%)
IbpA <65..158 CDD:223149 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.