DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14207 and cryabb

DIOPT Version :9

Sequence 1:NP_728275.1 Gene:CG14207 / 32955 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:125 Identity:48/125 - (38%)
Similarity:69/125 - (55%) Gaps:9/125 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TNSALPSRIPKQQNYVSDISSPLIQDEGDNKV------LKLRFDVSQYAPEEIVVKTVDQKLLVH 130
            |.:.:.|.:..|::  |.:.||...:.|.::|      ..|..||..:||||:.||.:...:.:|
Zfish    28 TEADVISSLYSQRS--SFLRSPSWMESGVSEVKMEKDQFSLSLDVKHFAPEELSVKIIGDFIEIH 90

  Fly   131 AKHEEKSDTKS-VYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIPI 189
            ||||::.|... |.||:.|::.:|.||:|.||.||||.||||||..||......|..|.|
Zfish    91 AKHEDRQDGHGFVSREFLRKYRVPVGVDPASITSSLSSDGVLTVTGPLKLSDGPERTIAI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 37/87 (43%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911 5/21 (24%)
ACD_HspB4-5-6 56..137 CDD:107233 36/80 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6558
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.